0 In Korea erreicht Hyperloop eine Geschwindigkeit von 1.000 km/h | connectiv.events
Seite auswählen

Screenshot YouTube

In Korea erreicht Hyperloop eine Geschwindigkeit von 1.000 km/h

23. November 2020 | Allgemein | Wirtschaft | Finanzen | Wissenschaft | Forschung | connectiv.events


Südkorea hofft, im Jahr 2024 das erste Hyperloop-Netzwerk (ein Hochgeschwindigkeitsverkehrssystem) zu starten

Ein Hyperloop-Prototyp in Südkorea hat Geschwindigkeiten von über 1.000 km/h erreicht, nur wenige Tage nachdem ein konkurrierendes System den ersten erfolgreichen Passagiertest mit dieser Technologie durchgeführt hat.

Das Korean Railroad Research Institute (Korail) gab am Mittwoch bekannt, dass ein durch ein Vakuum fahrender „Hyperrohrzug“ eine Höchstgeschwindigkeit von 1.019km/h erreicht hat.

Der Test fand an einem maßstabsgetreuen Modell statt und ist nach Angaben von Business Korea der erste seiner Art in der Welt. Die bisherige Höchstgeschwindigkeit, die ebenfalls von der Firma Korail festgelegt wurde, betrug 714km/h.

Südkorea hofft, bis zum Jahr 2024 ein Hyperloop-Netz in Betrieb nehmen zu können, das die Fahrzeit zwischen Seoul und Busan von drei Stunden auf 30 Minuten verkürzt.

Das Land verfügt bereits über Hochgeschwindigkeitszüge, die diese Strecke befahren, aber die Regierung ist bestrebt, die Verbindung nahezu im Überschallbereich zu betreiben.

Die revolutionäre Transittechnologie wurde erstmals 2012 von Elon Musk vorgeschlagen, doch der CEO von SpaceX und Tesla sagte, er habe nicht die Zeit, sich selbst auf ihre Entwicklung zu konzentrieren.




Seither haben mehrere Unternehmen und Startups die Herausforderung angenommen, wobei die vielversprechendsten Hyperloop TT und Virgin Hyperloop sind.

Anfang dieser Woche begrüßte Virgin Hyperloop auf einer 500 Meter langen Teststrecke vor den Toren von Las Vegas, Nevada, die allerersten menschlichen Passagiere an Bord einer Kapsel.

Die Fahrt dauerte nur 15 Sekunden, erreichte aber eine Geschwindigkeit von 172 km/h, was Mitbegründer Josh Giegel als „einen riesigen Sprung zum ultimativen Traum“ bezeichnete.

Weitere Länder, die derzeit die Technologie in Betracht ziehen, sind Frankreich, Indien, Saudi-Arabien und Großbritannien.

Eine potentielle Route zwischen den Flughäfen Gatwick und Heathrow könnte die 60 km lange Fahrt in einen 5-Minuten-Shuttle verwandeln, doch aufgrund des Umfangs der Baugenehmigungen, die für den Bau einer völlig neuen Form der Verkehrsinfrastruktur innerhalb einer bereits überfüllten Hauptstadt erforderlich sind, könnte es Jahrzehnte dauern, bis sie überhaupt realisiert wird.

Die Regierung Südkoreas sei bei der Erteilung von Baugenehmigungen und der Überwindung regulatorischer Hürden vorteilhafter, so Dirk Ahlborn, CEO von Hyperloop TT, was bedeutet, dass es das erste Land der Welt werden könnte, das ein Hyperloop-Massenverkehrssystem einführt





Fit durch den Herbst und Winter: 



Auch unsere Vorgänger konnten bis vor etwa sechs Millionen Jahren noch selbst Vitamin C im Körper herstellen. Durch eine Mutation ging diese Fähigkeit allerdings verloren. Man vermutet, dass es daran liegt, weil wir damals täglich über die frische Nahrung so viel Vitamin C aufgenommen haben, dass eine eigene Herstellung nicht mehr nötig war. So nahm der Steinzeitmensch durch seine Ernährung etwa 40-mal mehr Vitamin C zu sich als der Mensch heute. Womit die Natur allerdings nicht gerechnet hatte, ist unsere heutige nährstoffarme Ernährung. Und leider kann eine einmal verlorene Fähigkeit des Stoffwechsels nicht mehr wiedergewonnen werden.

Somit ist es immens wichtig das Allroundgenie Vitamin C täglich ausreichend zu sich zu nehmen. Und zwar nicht nur im Winter, sondern wirklich ganzjährig. Denn der Name „Allroundgenie“ ist Programm und belegt, dass das bekannteste Vitamin auch das am meisten unterschätzte ist. So spielt Vitamin C eben nicht nur eine wichtige Rolle bei der Unterstützung des Immunsystems im Winter, sondern es ist für rund 15000 Stoffwechselabläufe täglich unentbehrlich. hier klicken 


Der menschliche Körper besteht zum größten Teil aus Eiweiß und Wasser. Was uns aber funktionstüchtig macht und unserem Körper Festigkeit verleiht sind


letztendlich Mineralstoffe – speziell Magnesium und Calcium.
Dabei ist Calcium mehr als jeder andere Mineralstoff in unserem menschlichen Körper enthalten. Wie wir alle wissen, ist es unentbehrlich für unsere ca. 215 Knochen und Zähne und deren Erhaltung. Gerade weil unsere Knochen als lebendes Gewebe einem ständigen Auf- und Abbauprozess unterliegen, ist die ausreichende Verfügbarkeit von Calcium zur Erhaltung unserer Knochen unabdingbar. Aber Calcium hat noch weitere wichtige Aufgaben wie nämlich im Hinblick auf unsere Blutgerinnung, unseren Energiestoffwechsel sowie auch unserer Muskelfunktion. Selbst für unsere Verdauung spielt Calcium eine wichtige Rolle, da es zu einer normalen Funktion von unseren hierfür benötigten Verdauungsenzymen beiträgt. Was viele nicht wissen ist ferner, dass Calcium aber auch zu einer normalen Signalübertragung zwischen unseren Nervenzellen beiträgt.
Die EU-Kommission hat insoweit all diese festgestellten Wirkungen und Aufgaben von Calcium offiziell in einer Liste bestätigt, in der zusammenfassend aufgeführt wird, wozu Calcium als Nährstoff in unserem Körper im Einzelnen für unsere Gesundheit beitragen kann, nämlich
–    normaler Blutgerinnung
–    normalen Energiestoffwechsel
–    normaler Muskelfunktion
–    normalen Signalübertragung zwischen den Nervenzellen
–    normaler Funktion von Verdauungsenzymen
Calcium wird ferner benötigt zur Erhaltung normaler Knochen und normaler Zähne;Calcium hat zudem eine Funktion bei der Zellteilung und Zellspezialisierung.
Aber auch der Mineralstoff Magnesium hat ein schier unglaublich breites Spektrum an unterschiedlichen Aufgaben innerhalb unseres Körpers.


Heute weiß man, dass Vitamin D bzw. D3 nicht nur zur Erhaltung normaler Knochen beiträgt, sondern auch für andere Funktionen wichtig ist, indem es nämlich auch zur Erhaltung normaler Zähne, zur Erhaltung einer normalen Muskelfunktion, zu einer normalen Aufnahme/Verwertung von Calcium und Phosphor sowie zu einem normalen Calciumspiegel beiträgt. Ferner trägt Vitamin D zu einer normalen Funktion unseres Immunsystems bei und hat eine Funktion bei der Zellteilung.

Was viele vielleicht nicht wissen, ist aber, dass Vitamin K bzw. Vitamin K2 zur Erhaltung normaler Knochen beiträgt. Damit das in der Nahrung aufgenommene Calcium korrekt transportiert und verwertet werden kann, benötigt unser Körper nämlich zwei wichtige Proteine, das sog. Matrix-Gla-Protein (MGP) und das Hormon Osteokalzin, die jeweils von Vitamin K2 aktiviert werden. Ohne Vitamin K2 bleiben diese körpereigenen Proteine inaktiv mit der Folge, dass dadurch nicht nur die Knochen im Laufe der Zeit langsam entkalken können, sondern dass das aufgenommene Calcium nutzlos ausgeschieden oder abgelagert wird, wodurch es langfristig sogar zu unliebsamen Verkalkungen im Körper kommen kann. Die Funktion von Vitamin K2 auf unsere Gesundheit ist daher nicht zu unterschätzen, weshalb auf eine ausreichende Versorgung unseres Körpers mit Vitamin K2 peinlichst geachtet werden sollte.

Damit die wichtige Gesundheit Ihrer normalen Knochen gewährleistet bleibt, haben wir uns dazu entschlossen, diese hierfür vorstehend aufgezeigten Nährstoffe in einem  Produkt zusammenzuführen und zu vereinen, nämlich in unserer Produktneuheit „Vitamine K2 + D3 & Calcium“. hier klicken 


Zahlreiche Studien haben gezeigt, dass Kurkuma genauso wirksam gegen Entzündungen im Körper vorgeht wie so manch einschlägiges Medikament wie z. B. Hydrokortison, Phenylbutazon (Mittel gegen rheumatische Schmerzen, das jedoch so starke Nebenwirkungen hat, dass es nur noch selten verordnet wird), Aspirin und Ibuprofen – allerdings ohne deren schädliche Nebenwirkungen.
Die stark  antioxidative Wirkung von Kurkuma verhindert auch die Oxidation von Cholesterin. Und Cholesterin wird erst so richtig gefährlich, wenn es oxidiert, da es erst dann die Blutgefässe schädigt und so die Entstehung einer Arteriosklerose fördert.
Verschiedene Studien lassen ferner den Schluss zu, dass Kurkuma generell eine Schutzfunktion bei vielen Atemwegserkrankungen aufweist. Der Wirkmechanismus ist vermutlich wieder mit dem stark entzündungshemmenden und antioxidativen Potential erklärbar.
Da Kurkuma ein fettlöslicher Nährstoff ist, wird er im Darm des Menschen grundsätzlich schlecht resorbiert. Um dennoch das volle gesundheitliche Potential dieser fantastischen Natursubstanz nutzen zu können, haben wir unsere Kurkuma-Kapseln mit der Biosystem-Technologie veredelt. Diese sorgt für eine wesentlich bessere Bioverfügbarkeit. Probieren Sie es selber aus. Sie werden begeistert sein! hier klicken 

Danke für Ihre Unterstützung, die mir hilft die Seite aufrecht zu erhalten! 

via Überweisung:

IBAN: ES95 001901 82564 01001 4565

Bitte immer Spende als Zweck angeben!


Die Plattform von connectiv.events bietet Dir vielfältige und effektive Möglichkeiten, Dich, Deine Arbeit und/oder Dein Unternehmen bei einem thematisch breitgefächerten Publikum vorzustellen. Die Bekanntheit und auch die Beliebtheit von connectiv.events wächst von Tag zu Tag.

Im digitalen Zeitalter ist es besonders wichtig, einander real zu begegnen. Die Gelegenheit dazu hast Du bei unseren Events. Eine Termin-Übersicht findest Du im Event-Kalender.
Abonniere doch gleich unseren Youtube-Kanal. Damit unterstützt Du unseren Bekanntheitsgrad und verpasst keine neuen Produktionen mit spannenden Themen und Gästen.
Verpasse auch keine Informationen über kommende Events, sowie interessante Artikel, Beiträge und Menschen und melde Dich ebenfalls für unseren Newsletter an.
Wir entwickeln unsere Plattform ständig weiter und wünschen Dir viel Freude beim Stöbern auf connectiv.events


Weiter lesen auf:







WP Twitter Auto Publish Powered By : XYZScripts.com

Pin It on Pinterest

Share This